Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650025.1 | internal | 223 | 1-669(+) |
Amino Acid sequence : | |||
TGVFAEIFDGEVYKYYSEGEWKKSSSGKSVGIINPTTRKTHYKVQACTQEEVNKAIENAKSAQKAWAKTPLWKRAELLHKAAAILKEHKGPIAECLVKEIAKPAKDAVTEVVRSGDLVSY CAEEGVRLLSEGKFLTSDSFPGNDRTKYCLVSKIPLGVVLAIPPFNYPVNLAVSKIAPALIAGNSLVLKPPTQGAVAALHMVHCFHLAGFPKGLISCITGKGS | |||
Physicochemical properties | |||
Number of amino acids: | 223 | ||
Molecular weight: | 24,021.638 | ||
Theoretical pI: | 9.207 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27305 | ||
Instability index: | 39.020 | ||
aromaticity | 0.076 | ||
GRAVY | -0.052 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.238 | ||
sheet | 0.269 |