Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650048.1 | internal | 230 | 1-690(+) |
Amino Acid sequence : | |||
RSILPVYKEVVAELKAAGASWIQFDEPTLVLDLDSEKLKAFTAAYSELESTLSGVNVVIETYFADVPAEAYKTLTSLKGVTGFGFDLVRGLKTLDLIKGGFPSGKYLFAGVVDGRNIWAN DLAASLSTLEALEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVEVNALARALSGQKDKEYFAANAAAQASRRSSPRVTNEAVQKAAAALKGSDHR | |||
Physicochemical properties | |||
Number of amino acids: | 230 | ||
Molecular weight: | 18,174.651 | ||
Theoretical pI: | 9.906 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 52.253 | ||
aromaticity | 0.083 | ||
GRAVY | -0.089 | ||
Secondary Structure Fraction | |||
Helix | 0.254 | ||
turn | 0.254 | ||
sheet | 0.314 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650048.1 | 5prime_partial | 169 | 692-183(-) |
Amino Acid sequence : | |||
LRWSEPFKAAAAFCTASLVTLGDDLLEAWAAALAAKYSLSFCPDKALAKAFTSTTFCAAKASHDLISSSSLVSLTRSTAVWRSEQEVDTTSLSLPTMPSRASRVLREAARSLAQMLRPST TPAKRYFPEGNPPLIKSRVFSPRTKSKPNPVTPFKEVSVLYASAGTSAK* | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 18,174.651 | ||
Theoretical pI: | 9.906 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 52.253 | ||
aromaticity | 0.083 | ||
GRAVY | -0.089 | ||
Secondary Structure Fraction | |||
Helix | 0.254 | ||
turn | 0.254 | ||
sheet | 0.314 |