Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650048.1	internal	230	1-690(+)
Amino Acid sequence :
RSILPVYKEVVAELKAAGASWIQFDEPTLVLDLDSEKLKAFTAAYSELESTLSGVNVVIETYFADVPAEAYKTLTSLKGVTGFGFDLVRGLKTLDLIKGGFPSGKYLFAGVVDGRNIWAN DLAASLSTLEALEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVEVNALARALSGQKDKEYFAANAAAQASRRSSPRVTNEAVQKAAAALKGSDHR
Physicochemical properties
Number of amino acids:		230
Molecular weight:		18,174.651
Theoretical pI:		9.906
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 21095
Instability index:		52.253
aromaticity		0.083
GRAVY		-0.089
Secondary Structure Fraction
Helix		0.254
turn		0.254
sheet		0.314

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650048.1	5prime_partial	169	692-183(-)
Amino Acid sequence :
LRWSEPFKAAAAFCTASLVTLGDDLLEAWAAALAAKYSLSFCPDKALAKAFTSTTFCAAKASHDLISSSSLVSLTRSTAVWRSEQEVDTTSLSLPTMPSRASRVLREAARSLAQMLRPST TPAKRYFPEGNPPLIKSRVFSPRTKSKPNPVTPFKEVSVLYASAGTSAK*
Physicochemical properties
Number of amino acids:		169
Molecular weight:		18,174.651
Theoretical pI:		9.906
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 21095
Instability index:		52.253
aromaticity		0.083
GRAVY		-0.089
Secondary Structure Fraction
Helix		0.254
turn		0.254
sheet		0.314