Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650050.1 | internal | 254 | 3-764(+) |
Amino Acid sequence : | |||
FFNKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAV GNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYR NLFDALVDSVYASL | |||
Physicochemical properties | |||
Number of amino acids: | 254 | ||
Molecular weight: | 28,216.992 | ||
Theoretical pI: | 9.185 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
Instability index: | 47.425 | ||
aromaticity | 0.106 | ||
GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
Helix | 0.366 | ||
turn | 0.291 | ||
sheet | 0.209 |