Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650051.1 | internal | 253 | 2-760(+) |
Amino Acid sequence : | |||
SSLIHMDVDHSFLPVPAPVKAAIFESFARQNIVESETDVRSGIQQFIKSNYGFTSDSSAEFIYGDSPLALFSKLVLCCIQEGGTMCFPSGSNGNYVSAAKFMNANIVNIPTQPETGFKLT EKNLTNSLETVNKPWVYLSGPTIGPTGVIYANDEVDKILSICAKFGAKVVIDTSFSGLEFNTVGWDGWNLEDSLSKLSSFGRRSFCVSLLGGLSFEMLTGGLTFGFLVLNEPILIDAFYS FPGLSKPHNTINY | |||
Physicochemical properties | |||
Number of amino acids: | 253 | ||
Molecular weight: | 27,495.919 | ||
Theoretical pI: | 4.854 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27180 | ||
Instability index: | 38.808 | ||
aromaticity | 0.119 | ||
GRAVY | 0.125 | ||
Secondary Structure Fraction | |||
Helix | 0.348 | ||
turn | 0.316 | ||
sheet | 0.213 |