Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650067.1 | 3prime_partial | 143 | 304-732(+) |
Amino Acid sequence : | |||
MDEKSPRTRLLASVCLIVIGHSSSHLQDMELKNKLILILVDLLEEPDRVGDEVPFALANLIADKEDLQKLAFEANALDKLCNFLQKGTLQVKRLEGLLLAMAALCSSLENCRSRFLSLQV LNPVTGALKHDSAEVRTAACICI | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 15,726.304 | ||
Theoretical pI: | 5.598 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 375 | ||
Instability index: | 42.233 | ||
aromaticity | 0.028 | ||
GRAVY | 0.227 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.175 | ||
sheet | 0.385 |