Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650085.1 | internal | 260 | 2-781(+) |
Amino Acid sequence : | |||
FNKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVG NEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRN LFDALVDSVYASLEKAGGGG | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 28,626.387 | ||
Theoretical pI: | 9.161 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
Instability index: | 47.985 | ||
aromaticity | 0.100 | ||
GRAVY | -0.043 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.300 | ||
sheet | 0.212 |