Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650102.1 | internal | 253 | 3-761(+) |
Amino Acid sequence : | |||
ATKMGTSKSNRFSMILLSHIFLFSISWWSSVLAQENFLQCLSLHSDQPPIPVYTPNTSSYSSILQSSIQNLRFISSDTPKPQVIITPSHESHVQAAVICCRKHGLQIRVRSGGHDYEGLS YTSDVPFVVVDLANFESIVVDVEDRSAWVQAGATIGQVYYRIAEKTSAYGFPAGACPTVGVGGHFSAGGYGGLFRKYGLAADNIIDARIVTVDGKISDKESMGEDLFWAIRGGGGGSFGV ILSWKIRLVPVPP | |||
Physicochemical properties | |||
Number of amino acids: | 253 | ||
Molecular weight: | 27,390.820 | ||
Theoretical pI: | 7.225 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 41160 | ||
Instability index: | 36.938 | ||
aromaticity | 0.103 | ||
GRAVY | 0.075 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.296 | ||
sheet | 0.178 |