Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650113.1 | internal | 251 | 3-755(+) |
Amino Acid sequence : | |||
PLRCPLAPSTLPSLRTINPPNGNFCFCSSKPILLGFQSRFRCRTRKTMATSSPSTFVQVKEKIELTEKEKQIFERLLQVLRHFNLQTQLRVAGGWVRDKLIGKQCYDIDIALDNMMGREF CEKVNEYLSSSGQEVQGIGIIQCNPDQSKHLETARMRLFDIWIDFVNLRSESYSENSRIPTMKFGTAIEDAYRRDLTINSLFYNINTNSVEDITGRGLSDLKFGRIVTPLPPKETFLDDP LRVLRAIRFGA | |||
Physicochemical properties | |||
Number of amino acids: | 251 | ||
Molecular weight: | 28,746.790 | ||
Theoretical pI: | 9.125 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18825 | ||
Instability index: | 46.046 | ||
aromaticity | 0.088 | ||
GRAVY | -0.339 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.239 | ||
sheet | 0.219 |