Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650116.1 | internal | 250 | 3-752(+) |
Amino Acid sequence : | |||
GTGVFAEIFDGEVYKYYSEGEWKKSSSGKSVGIINPTTRKTHYKVQACTQEEVNKAIENAKSAQKAWAKTPLWKRAELLHKAAAILKEHKGPIAECLVKEIAKPAKDAVTEVVRSGDLVS YCAEEGVRLLSEGKFLTSDSFPGNDRTKYCLVSKIPLGVVLAIPPFNYPVNLAVSKIAPALIAGNSLVLKPPTQGAVAALHMVHCFHLAGFPKGLISCITGKGSEIGDFLTMHPGVNCIS FTGGDTGIAI | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 26,726.664 | ||
Theoretical pI: | 8.862 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27305 | ||
Instability index: | 37.720 | ||
aromaticity | 0.076 | ||
GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.248 | ||
sheet | 0.256 |