Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650128.1 | 3prime_partial | 211 | 141-773(+) |
Amino Acid sequence : | |||
MKVIEKIREAKEQDRVVFSFEFFPPKTEDGVENLFERMDRMVAHNPSFCDITWGAGGSTADLTLDISNKMQNMICVETMMHLTCTNMPVEKLEHALDTIKSNGIQNVLALRGDPPHGQDK FVQVEGGFACALDLVKHIRAKYGDYFGITVAGYPEAHPDVIQSNGVATLEGYQNDLAYLKKKVDAGADLIITQLFYDTDIFLKFVNDCRQI | |||
Physicochemical properties | |||
Number of amino acids: | 211 | ||
Molecular weight: | 13,163.982 | ||
Theoretical pI: | 9.595 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 63.908 | ||
aromaticity | 0.084 | ||
GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.319 | ||
sheet | 0.210 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650128.1 | 3prime_partial | 203 | 611-3(-) |
Amino Acid sequence : | |||
MCLWIPGNGNAKIITIFGSNMFNQIKSASETSFNLNKLILSVRRISSESENILNTIRFDSIKSMLQLLHRHIRAGQMHHCFYADHVLHLVRNVEGQIGRGTTSAPSNVAKTRVMCDHPIH PLEQILHSIFGFRRKELKREHHPVLLLGLADLLDNLHPPLLQQQPQIRRDTIAKCRDESGETGEGKIGLLHLYILFRFRFEEC | |||
Physicochemical properties | |||
Number of amino acids: | 203 | ||
Molecular weight: | 13,163.982 | ||
Theoretical pI: | 9.595 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 63.908 | ||
aromaticity | 0.084 | ||
GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.319 | ||
sheet | 0.210 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650128.1 | 3prime_partial | 119 | 358-2(-) |
Amino Acid sequence : | |||
MFCILLEMSRVRSAVEPPAPQVMSQKLGLCATIRSILSNRFSTPSSVFGGKNSNENTTRSCSLASRIFSITFILLCFNNNHRSGGILLQNAETRVERQGKGRSGYCIYIYFSDSDLKSA | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,163.982 | ||
Theoretical pI: | 9.595 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 63.908 | ||
aromaticity | 0.084 | ||
GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.319 | ||
sheet | 0.210 |