Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650132.1	internal	257	3-773(+)
Amino Acid sequence :
TVSRFPTNTDALEAGGVPWGVTVTPFAATDEHGNPPAYGSDGHLLPRCENCWAYFNSHCELDQWAWNCALCGTLNGLTTESIARYSRPESCPEMMSSFIDVEIPDGSEGEAMQARPVYVA AVDLSSSEEFLELVKSALLAALEALAPGSLFGLATFSHKLGLYDVQGPVPVVKNIFVPQDSDDTIPIALEDVMPLISFLAPVETCKDHIAAALETLKPTTSWERNTSSGEGLDGILMGAR GFGGAMEALFNYLGSEY
Physicochemical properties
Number of amino acids:		257
Molecular weight:		11,541.022
Theoretical pI:		11.333
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8605
Instability index:		70.934
aromaticity		0.048
GRAVY		-0.419
Secondary Structure Fraction
Helix		0.279
turn		0.279
sheet		0.212

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650132.1	5prime_partial	104	2-316(+)
Amino Acid sequence :
NGISISDEHRRLGGRRSAMGSHGDAICGDGRAWKPAGLRLRRSSSTTLRELLGVLQLALRVRSVGVELRSMRDLKRSHYRINRSVFASGVVSRDDVFVYRCGDS*
Physicochemical properties
Number of amino acids:		104
Molecular weight:		11,541.022
Theoretical pI:		11.333
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8605
Instability index:		70.934
aromaticity		0.048
GRAVY		-0.419
Secondary Structure Fraction
Helix		0.279
turn		0.279
sheet		0.212