Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650139.1	internal	223	3-671(+)
Amino Acid sequence :
SILPVYKEVVAELKAAGASWIQFDEPTLVLDLDSEKLKAFTAAYSELESTLSGVNVVIETYFADVPAEAYKTLTSLKGVTGFGFDLVRGLKTLDLIKGGFPSGKYLFAGVVDGRNIWAND LAASLSTLEALEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVEVNALARALSGQKDKEYFAANAAAQASRRSSPRVTNEAVQKAAAAL
Physicochemical properties
Number of amino acids:		223
Molecular weight:		17,258.617
Theoretical pI:		9.907
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15595
Instability index:		46.715
aromaticity		0.074
GRAVY		-0.064
Secondary Structure Fraction
Helix		0.247
turn		0.253
sheet		0.315

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650139.1	5prime_partial	162	670-182(-)
Amino Acid sequence :
KAAAAFCTASLVTLGDDLLEAWAAALAAKYSLSFCPDKALAKAFTSTTFCAAKASHDLISSSSLVSLTRSTAVWRSEQEVDTTSLSLPTMPSRASRVLREAARSLAQMLRPSTTPAKRYF PEGNPPLIKSRVFSPRTKSKPNPVTPFKEVSVLYASAGTSAK*
Physicochemical properties
Number of amino acids:		162
Molecular weight:		17,258.617
Theoretical pI:		9.907
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15595
Instability index:		46.715
aromaticity		0.074
GRAVY		-0.064
Secondary Structure Fraction
Helix		0.247
turn		0.253
sheet		0.315