Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650142.1 | internal | 275 | 2-826(+) |
Amino Acid sequence : | |||
SVLNDAELSFVEAENSSLIHMDVDHSFLPVPAPVKAAIFESFARQNIVESETDVRSGIQQFIKSNYGFTSDSSAEFIYGDSPLALFSKLVLCCIQEGGTMCFPSGSNGNYVSAAKFMNAN IVNIPTQPETGFKLTEKNLTNSLETVNKPWVYLSGPTIGPTGVIYANDEVDKILSICAKFGAKVVIDTSFSGLEFNTVGWDGWNLEDSLSKLSSFGRRSFCVSLLGGLSFEMLTGGLTFG FLVLNEPILIDAFYSFPGLSKPHNTINYAIKKLLD | |||
Physicochemical properties | |||
Number of amino acids: | 275 | ||
Molecular weight: | 29,896.598 | ||
Theoretical pI: | 4.729 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27180 | ||
Instability index: | 36.747 | ||
aromaticity | 0.113 | ||
GRAVY | 0.124 | ||
Secondary Structure Fraction | |||
Helix | 0.349 | ||
turn | 0.305 | ||
sheet | 0.233 |