Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650174.1 | internal | 159 | 3-479(+) |
Amino Acid sequence : | |||
FLGELKRAILSTVDEASWLWRPENQAQVPLPHNHPTETLKSHHVPLSPNLTTCHRSLSDADRPVYCCPPNPEADEPVIDFQFPDLSTTPVRIRRPAHKLDQAYMSKYNKALTIMKSLPST DPRSFMRQANIHCIYCTGAYNQKHSNSLLKIHRSRMFFP | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 18,274.711 | ||
Theoretical pI: | 9.062 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
Instability index: | 63.081 | ||
aromaticity | 0.082 | ||
GRAVY | -0.587 | ||
Secondary Structure Fraction | |||
Helix | 0.258 | ||
turn | 0.258 | ||
sheet | 0.220 |