Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650175.1 | internal | 195 | 3-587(+) |
Amino Acid sequence : | |||
LGLILHHNALGRIFEVRCLHIPVFDRTPFEGLVKYVENTVRLEYALSPHKPIYLVGDSFGGCLALAVAARNPAIDLVLVLANPATSFDKSQFQPLLPILESLPEELHFSLPYLLSFIMGD PVRMSMATIDNRLPPLQSLEQLSSHLVALLPRLSVVADIIPKQTLLWKLKLLKSAASYANSRLHAVTADVLVLAS | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 21,492.091 | ||
Theoretical pI: | 7.222 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 48.204 | ||
aromaticity | 0.072 | ||
GRAVY | 0.442 | ||
Secondary Structure Fraction | |||
Helix | 0.400 | ||
turn | 0.226 | ||
sheet | 0.344 |