Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650176.1 | internal | 202 | 3-608(+) |
Amino Acid sequence : | |||
PKKPHVVLIPFPAQGHVHPFMQLAQLLHSQGFYITFVNTEFNHGRLLRSKGLKTLKGLTDFKFETISDGLPPSDRDATQDPIALCDSFRKDNCLKPLLELLAKLNSSSSTYSGVPPVSCI ISDGAMSFAIKAAECLGIPEIQFWTASACGLLGYLQFRELVSRGITPLKDETYLSNGYLDMKLDWVPGMPNIRLKDLPSFVQ | |||
Physicochemical properties | |||
Number of amino acids: | 202 | ||
Molecular weight: | 22,383.714 | ||
Theoretical pI: | 8.055 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
Instability index: | 40.238 | ||
aromaticity | 0.094 | ||
GRAVY | -0.033 | ||
Secondary Structure Fraction | |||
Helix | 0.332 | ||
turn | 0.262 | ||
sheet | 0.248 |