Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650176.1	internal	202	3-608(+)
Amino Acid sequence :
PKKPHVVLIPFPAQGHVHPFMQLAQLLHSQGFYITFVNTEFNHGRLLRSKGLKTLKGLTDFKFETISDGLPPSDRDATQDPIALCDSFRKDNCLKPLLELLAKLNSSSSTYSGVPPVSCI ISDGAMSFAIKAAECLGIPEIQFWTASACGLLGYLQFRELVSRGITPLKDETYLSNGYLDMKLDWVPGMPNIRLKDLPSFVQ
Physicochemical properties
Number of amino acids:		202
Molecular weight:		22,383.714
Theoretical pI:		8.055
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18450 18700
Instability index:		40.238
aromaticity		0.094
GRAVY		-0.033
Secondary Structure Fraction
Helix		0.332
turn		0.262
sheet		0.248