Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650190.1	internal	269	1-807(+)
Amino Acid sequence :
QRCAALVPRVRTLVRGIIEEHRAVHGGSGSGDNGYELTDESDFVDVLLSLDGEGKLNEEDMISILWEMIFRGTDTMGILTEWIMAELILNPNIQAKLQNELDSVVANNHDITDAVVTNLP YLQAVVKETLRVHPPGPLLSWARLSTSDVKLGNGMLIPSNTTAMVNMWAITHDPNLWEDPMVFKPERFLESEGGVNVDVRGNDLRLAPFGAGRRVCPGKNLGLVTVTMWVAKLVQHFKWV EDSEMPVDLSEQMKLACEMKTPLTAIAIA
Physicochemical properties
Number of amino acids:		269
Molecular weight:		18,095.757
Theoretical pI:		9.978
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 7365
Instability index:		51.563
aromaticity		0.053
GRAVY		0.281
Secondary Structure Fraction
Helix		0.287
turn		0.304
sheet		0.246

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650190.1	5prime_partial	171	806-291(-)
Amino Acid sequence :
AIAIAVRGVFISQANFICSLRSTGISESSTHLKCCTNLATHMVTVTRPRFLPGHTLRPAPNGASLRSLPLTSTLTPPSLSKNLSGLNTIGSSQRLGSCVIAHMFTIAVVLDGMSIPLPSF TSEVESLAHERRGPGGCTLRVSLTTACRYGRLVTTASVMSWLFATTESSSF*
Physicochemical properties
Number of amino acids:		171
Molecular weight:		18,095.757
Theoretical pI:		9.978
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 7365
Instability index:		51.563
aromaticity		0.053
GRAVY		0.281
Secondary Structure Fraction
Helix		0.287
turn		0.304
sheet		0.246