Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650190.1 | internal | 269 | 1-807(+) |
Amino Acid sequence : | |||
QRCAALVPRVRTLVRGIIEEHRAVHGGSGSGDNGYELTDESDFVDVLLSLDGEGKLNEEDMISILWEMIFRGTDTMGILTEWIMAELILNPNIQAKLQNELDSVVANNHDITDAVVTNLP YLQAVVKETLRVHPPGPLLSWARLSTSDVKLGNGMLIPSNTTAMVNMWAITHDPNLWEDPMVFKPERFLESEGGVNVDVRGNDLRLAPFGAGRRVCPGKNLGLVTVTMWVAKLVQHFKWV EDSEMPVDLSEQMKLACEMKTPLTAIAIA | |||
Physicochemical properties | |||
Number of amino acids: | 269 | ||
Molecular weight: | 18,095.757 | ||
Theoretical pI: | 9.978 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
Instability index: | 51.563 | ||
aromaticity | 0.053 | ||
GRAVY | 0.281 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.304 | ||
sheet | 0.246 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650190.1 | 5prime_partial | 171 | 806-291(-) |
Amino Acid sequence : | |||
AIAIAVRGVFISQANFICSLRSTGISESSTHLKCCTNLATHMVTVTRPRFLPGHTLRPAPNGASLRSLPLTSTLTPPSLSKNLSGLNTIGSSQRLGSCVIAHMFTIAVVLDGMSIPLPSF TSEVESLAHERRGPGGCTLRVSLTTACRYGRLVTTASVMSWLFATTESSSF* | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 18,095.757 | ||
Theoretical pI: | 9.978 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
Instability index: | 51.563 | ||
aromaticity | 0.053 | ||
GRAVY | 0.281 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.304 | ||
sheet | 0.246 |