Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650197.1 | internal | 205 | 2-616(+) |
Amino Acid sequence : | |||
VATVPVVTLNSGHKMPVLGTGTASFPVPPLEELKKVIMEAMEVGYRHFDTAAMYQSEEGLGAAIKEALEKGLIKSRDELFITTKLWCNNAQPHLVLPAIRDSLRRLRLEYVDLYLIHYPV RLKEDLLSMDCKEDEIFPIDIKSVWSAMEEIHNLGLAKSIGVSNFTCKKLTDLLAHAKIPPAVNQVELHPAWQQKKLREFCQEKG | |||
Physicochemical properties | |||
Number of amino acids: | 205 | ||
Molecular weight: | 23,117.724 | ||
Theoretical pI: | 6.418 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
Instability index: | 45.674 | ||
aromaticity | 0.068 | ||
GRAVY | -0.122 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.185 | ||
sheet | 0.322 |