Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650201.1 | 3prime_partial | 219 | 127-783(+) |
Amino Acid sequence : | |||
MSRKMLIDDEVSNAQEEAEKYDYDLFVIGAGSGGVRASRTAAGFGAKVAICELPFHPISSEVVGGVGGTCVIRGCVPKKILVYGASFSGEFEDARNYGWELNEKIGLNWKKLLENKTQEI VRLNGIYKRLLSNAGVKMFEGEGRVIGPNEVELTQLDGTRMSFSAKHILIATGSRAHRPAIPGMELAITSDEALSLEELPKRAVVLGGGYIAVEFASIW | |||
Physicochemical properties | |||
Number of amino acids: | 219 | ||
Molecular weight: | 13,448.292 | ||
Theoretical pI: | 10.391 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 51.556 | ||
aromaticity | 0.096 | ||
GRAVY | 0.452 | ||
Secondary Structure Fraction | |||
Helix | 0.439 | ||
turn | 0.123 | ||
sheet | 0.368 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650201.1 | complete | 114 | 152-496(+) |
Amino Acid sequence : | |||
MRSATLKKRRRSMIMICLLLVPAVAVFVLPELQLDLELRLLFVSFLSIQLAQKLLGELVEHVSFVAVYQKRFWYMEHLFQVNLRMLEIMAGSSMKKLVLTGKSFWRIRHKKLLD* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 13,448.292 | ||
Theoretical pI: | 10.391 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 51.556 | ||
aromaticity | 0.096 | ||
GRAVY | 0.452 | ||
Secondary Structure Fraction | |||
Helix | 0.439 | ||
turn | 0.123 | ||
sheet | 0.368 |