Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650204.1	internal	277	1-831(+)
Amino Acid sequence :
PCSCRASATLLMACGLADLAFHFTGPHERPLRSRKLAPVNSSGIFYLKLGKLHHCGIKHHESPYRKKMATIMQAVAVPVPVPAPSPAPTSGLDSEVHRKQLCEKYGFTQIGEPLPNNITL RDIIDTLPKKVFEIDDSKAWKSVLISATSYALGIFMISQAPWYLLPLAWAWTGTAITGFFVIGHDCAHKSFSKNKLVEDIVGTLAFLPLIYPYEPWRFKHDKHHAKTNMLTEDTAWHPVW KEEFDTSPFLRKAIVFGYGPFRTWMSIAHWLIWHFDL
Physicochemical properties
Number of amino acids:		277
Molecular weight:		11,760.516
Theoretical pI:		8.799
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10220
Instability index:		23.553
aromaticity		0.080
GRAVY		0.407
Secondary Structure Fraction
Helix		0.321
turn		0.277
sheet		0.214

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650204.1	complete	112	527-189(-)
Amino Acid sequence :
MAVPVQAHARGSKYHGACEIMKIPNAYEVADIKTDFQALLSSISKTFLGRVSIISLSVILLGSGSPIWVKPYFSHNCFRCTSLSNPDVGAGDGAGTGTGTATACIIVAIFLR*
Physicochemical properties
Number of amino acids:		112
Molecular weight:		11,760.516
Theoretical pI:		8.799
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10220
Instability index:		23.553
aromaticity		0.080
GRAVY		0.407
Secondary Structure Fraction
Helix		0.321
turn		0.277
sheet		0.214