Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650209.1 | internal | 224 | 1-672(+) |
Amino Acid sequence : | |||
IEDVTSNPDESQKRVLCEILSDSAHVEYLQRHGLDGRTDRETFKKTMPVITYEDLLPDISRIANGDSSPILCSDRISEFLTSSGTSAGERKLMPTIEKEHDRRSLLYSLLMPVMSQFVPD LDKGKGMYFLFIKSESKTPGGLVARPVLTSYYKSTHFRNRPFDPYTNYTSPNETILCSDSYQSMYSQMLCGLFQNKEVLRVGAVFASGFLRAIRFLEKNWTLLC | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 25,509.828 | ||
Theoretical pI: | 6.495 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20650 | ||
Instability index: | 54.265 | ||
aromaticity | 0.098 | ||
GRAVY | -0.353 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.250 | ||
sheet | 0.237 |