Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650219.1 | internal | 206 | 2-619(+) |
Amino Acid sequence : | |||
AYVFGGEFKPRVPVDNDVHVFDLQTGEWSVAEATGDVPPPRVGVTMVSVGNTIYVFGGRDSGHNELNELYSFDTCTNKWTLISSGDTGPFSRSYHSMAADDRRLFVFGGCGVDGRLNDLW ALDVENHQWLKFPSPGARCRARGGPGLVVCEGKVWVLYGFSGEELDDVHCFDPVNGKWVQVEAKGEKPSARSVFSTVVIGRCIVMY | |||
Physicochemical properties | |||
Number of amino acids: | 206 | ||
Molecular weight: | 22,615.154 | ||
Theoretical pI: | 5.194 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41940 42315 | ||
Instability index: | 27.422 | ||
aromaticity | 0.117 | ||
GRAVY | -0.174 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.282 | ||
sheet | 0.175 |