Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650220.1 | internal | 230 | 1-690(+) |
Amino Acid sequence : | |||
NPTTIAPPLQRGWQSANRAGSLQSKAVEDTQGKLSDLSKHNRQGSAGHDDSGSDTGAPHCKGEFDDDNDDDSMLEDTDDDILSDDFDSDGDGSQKSHESRKKNKWFKPFFDELDKLTVEE ISEPSRQWHCPACRNGPGAIDWYRGLHPLMAHAKTKGASRVRLHRELAELLDEELSLRGASIIPAGETFGKWKGLRGTVSDHEIVWPPMVVVMNTVLEKDENDKWIGMGN | |||
Physicochemical properties | |||
Number of amino acids: | 230 | ||
Molecular weight: | 25,534.772 | ||
Theoretical pI: | 4.959 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39990 40115 | ||
Instability index: | 36.813 | ||
aromaticity | 0.061 | ||
GRAVY | -0.907 | ||
Secondary Structure Fraction | |||
Helix | 0.213 | ||
turn | 0.270 | ||
sheet | 0.230 |