Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650230.1 | internal | 226 | 3-680(+) |
Amino Acid sequence : | |||
IVAMAATGLAKINALSSQWVGQPPVNHRHRASSGISFRRAAAAAPIRAGSYTEELVQTAKSIASPGRGILAIDESNATCGKRLASIGLENTETNRQAYRQLLLTTPGLGEYISGAILFEE TLYQSTTNGKKFVDCLKDENIVPGIKVDKGLVPLPGSNNESWCQGLDGLASRSAEYYKQGARFAKWRTVVSIPCGPSALAVKEAAWGLARYAAISQDNGLVPIVEP | |||
Physicochemical properties | |||
Number of amino acids: | 226 | ||
Molecular weight: | 24,028.045 | ||
Theoretical pI: | 9.064 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32680 | ||
Instability index: | 34.887 | ||
aromaticity | 0.066 | ||
GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.274 | ||
sheet | 0.283 |