Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650231.1 | 3prime_partial | 227 | 118-798(+) |
Amino Acid sequence : | |||
MMVSHLEWRMVSLAILLLLVPRFPATSQVHLANEKRVKSAVFLSPMFVLGPGSVENKYYYNIGFPRGHIFLKEFDAEVIDEEGNPVPLHETYLHHWVVERYYALRDVDISKERGDRKLNR PKILSARNSGVCDDNTLGQYFGLGSETRKTATYVPDPYGIEVGNPAIIPDGYEQRWLLNVHAIDTRGVEDPLGCTECRCDLYNITKDESGRPLSTGYKGGLRCCYDQ | |||
Physicochemical properties | |||
Number of amino acids: | 227 | ||
Molecular weight: | 25,785.064 | ||
Theoretical pI: | 5.985 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36245 | ||
Instability index: | 41.575 | ||
aromaticity | 0.101 | ||
GRAVY | -0.356 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.242 | ||
sheet | 0.233 |