Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650246.1 | complete | 176 | 90-620(+) |
Amino Acid sequence : | |||
MAITNFPVINMEKLNGEERAATMEAIKDACENWGFFELVNHGISYELMDKVEKLTKEHYKKCMEQRFKELVASKALEGVEAEIKDMDWESTFFIKHLPESNIFDLPDLADEYKKSMKQFA LDLEKLAELLLDLLCENLGLEKGYLKKAFCGSKGPTFGTKIGNYPPCPRPELVKGL* | |||
Physicochemical properties | |||
Number of amino acids: | 176 | ||
Molecular weight: | 12,574.253 | ||
Theoretical pI: | 4.961 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 17.147 | ||
aromaticity | 0.127 | ||
GRAVY | 0.078 | ||
Secondary Structure Fraction | |||
Helix | 0.409 | ||
turn | 0.136 | ||
sheet | 0.282 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650246.1 | 5prime_partial | 110 | 782-450(-) |
Amino Acid sequence : | |||
VLPVRYDLELVTEVYNDRVVHWGHVDPLVILKELEAADLIVLEEQYDATGVGVSSETLNQFRAWAWRVVTNFGPKGRTFGATEGLFKIAFFKAEVFTEQVQEKLCKFLQV* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 12,574.253 | ||
Theoretical pI: | 4.961 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 17.147 | ||
aromaticity | 0.127 | ||
GRAVY | 0.078 | ||
Secondary Structure Fraction | |||
Helix | 0.409 | ||
turn | 0.136 | ||
sheet | 0.282 |