Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650246.1	complete	176	90-620(+)
Amino Acid sequence :
MAITNFPVINMEKLNGEERAATMEAIKDACENWGFFELVNHGISYELMDKVEKLTKEHYKKCMEQRFKELVASKALEGVEAEIKDMDWESTFFIKHLPESNIFDLPDLADEYKKSMKQFA LDLEKLAELLLDLLCENLGLEKGYLKKAFCGSKGPTFGTKIGNYPPCPRPELVKGL*
Physicochemical properties
Number of amino acids:		176
Molecular weight:		12,574.253
Theoretical pI:		4.961
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 20970
Instability index:		17.147
aromaticity		0.127
GRAVY		0.078
Secondary Structure Fraction
Helix		0.409
turn		0.136
sheet		0.282

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650246.1	5prime_partial	110	782-450(-)
Amino Acid sequence :
VLPVRYDLELVTEVYNDRVVHWGHVDPLVILKELEAADLIVLEEQYDATGVGVSSETLNQFRAWAWRVVTNFGPKGRTFGATEGLFKIAFFKAEVFTEQVQEKLCKFLQV*
Physicochemical properties
Number of amino acids:		110
Molecular weight:		12,574.253
Theoretical pI:		4.961
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 20970
Instability index:		17.147
aromaticity		0.127
GRAVY		0.078
Secondary Structure Fraction
Helix		0.409
turn		0.136
sheet		0.282