Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650252.1 | 3prime_partial | 246 | 37-774(+) |
Amino Acid sequence : | |||
MGNLLCCVQVDQSTVAIKERFGKFNEVLEPGCHCLPWIFGCQLAGHLSLRLQQLDVRCETKTKDNVFVNVVASVQYRALADKASDAFYKLSNTRTQIQAYVFDVIRASVPKLNLDDAFEQ KNEIAKAVEEELEKAMSAYGYEIVQTLIVDIEPDEHVKRAMNEINAAARLRVAANEKAEAEKILQIKRAEGEAESKYLSGLGIARQRQAIVDGLRDSVLGFSVNVPGTTAKDVMDMVLVT QYFDTM | |||
Physicochemical properties | |||
Number of amino acids: | 246 | ||
Molecular weight: | 11,589.411 | ||
Theoretical pI: | 10.220 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 62.153 | ||
aromaticity | 0.103 | ||
GRAVY | 0.390 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.271 | ||
sheet | 0.224 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650252.1 | complete | 107 | 773-450(-) |
Amino Acid sequence : | |||
MVSKYCVTRTMSITSFAVVPGTLTEKPSTLSRRPSTIACRWRAIPSPERYFDSASPSARLICRIFSASAFSFAATLSLAAALISFIARFTCSSGSMSTIRVCTISYP* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 11,589.411 | ||
Theoretical pI: | 10.220 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 62.153 | ||
aromaticity | 0.103 | ||
GRAVY | 0.390 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.271 | ||
sheet | 0.224 |