Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650273.1	internal	258	1-774(+)
Amino Acid sequence :
VPSSISQDRMIIVANQLPVKAKRRPDNNCWSFSWDEDSLLLQLKDGLPDDMEVIYVGSLKVEVDPNEQDDVSQILLEKFKSVPTFLPPDILSKYYHGFCKLQLWPLFHYMLPFSADHGGR FDRSLWEAYVAANKLFSQKVIEVINPEDDFVWIHDYHLMVLPTFLRRRFNRLRMGFFLHSPFPSSEIYRTLPVREEILKALLNSDLIGFHTFDYARHFLSCCSRMLGLEYQSKRGYIGLE YYGRMVGIKIMPVGIHMG
Physicochemical properties
Number of amino acids:		258
Molecular weight:		30,160.588
Theoretical pI:		6.534
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		45380 45630
Instability index:		64.290
aromaticity		0.132
GRAVY		-0.139
Secondary Structure Fraction
Helix		0.380
turn		0.225
sheet		0.236