Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650282.1 | internal | 270 | 2-811(+) |
Amino Acid sequence : | |||
LLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVP FVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASL EKAGGGGLEIVVSESGWPSAGGTATSIDTL | |||
Physicochemical properties | |||
Number of amino acids: | 270 | ||
Molecular weight: | 29,562.338 | ||
Theoretical pI: | 6.538 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31860 31860 | ||
Instability index: | 45.765 | ||
aromaticity | 0.096 | ||
GRAVY | -0.007 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.304 | ||
sheet | 0.215 |