Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650287.1	internal	279	2-838(+)
Amino Acid sequence :
FNKTTSSPMAATVLLLGLFLASLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSQQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVG NEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRN LFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATS
Physicochemical properties
Number of amino acids:		279
Molecular weight:		30,473.332
Theoretical pI:		8.624
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		31860 31860
Instability index:		47.551
aromaticity		0.097
GRAVY		-0.030
Secondary Structure Fraction
Helix		0.348
turn		0.308
sheet		0.215