Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650304.1 | internal | 252 | 1-756(+) |
Amino Acid sequence : | |||
VPFRLAPPMDPYRHRPSSSFNTPFWTNNHGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGS PETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDIGVPQDYRHMEGSGVNTYTLINKAGKAYYVKFHWKPTCGV KSLLEDEAIKVG | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 13,668.051 | ||
Theoretical pI: | 11.345 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 51.392 | ||
aromaticity | 0.106 | ||
GRAVY | 0.613 | ||
Secondary Structure Fraction | |||
Helix | 0.407 | ||
turn | 0.268 | ||
sheet | 0.268 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650304.1 | 5prime_partial | 123 | 2-373(+) |
Amino Acid sequence : | |||
FRFASLRQWIPTGTVHPAPSIHLSGPTTMVLLFGTITPHSLLDLEAQFSSRIIILWRSLLILIVNEFLNVLFTPGEPVPRAFLKSPMIFLTSHAQIFFVLLASRPQSLFVSQPSSMSVAA PKL* | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,668.051 | ||
Theoretical pI: | 11.345 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 51.392 | ||
aromaticity | 0.106 | ||
GRAVY | 0.613 | ||
Secondary Structure Fraction | |||
Helix | 0.407 | ||
turn | 0.268 | ||
sheet | 0.268 |