Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650311.1 | internal | 267 | 3-803(+) |
Amino Acid sequence : | |||
ETRVRVPIGFLFVAFLVTVSCFNLISADGESEGVKEFVVTLDNTNFHDFVSKQPFIVVEFYAPWCGHCKSLAPEYEKAASILVNNDPPVILAKIDANDEANKGIASEFDVRGYPTIKILR NGGKDVQEYKGPREADGIVEYLKKQAGPASAEITSVEGAGSLISGKKIVVVGIFPEFSGEEYENFSATANKLRSDYDFAHTKDAKLLPRGDAVSGPLVRLFKPFDELSVDFKDFHVDALE KFIEEASVPIVTMFNKDPSNHPYVINS | |||
Physicochemical properties | |||
Number of amino acids: | 267 | ||
Molecular weight: | 29,404.922 | ||
Theoretical pI: | 4.944 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17545 | ||
Instability index: | 26.792 | ||
aromaticity | 0.109 | ||
GRAVY | -0.120 | ||
Secondary Structure Fraction | |||
Helix | 0.337 | ||
turn | 0.247 | ||
sheet | 0.232 |