Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650323.1 | internal | 270 | 3-812(+) |
Amino Acid sequence : | |||
SINDHHEEYSNALVDRRNVLLGLGAGLYGFAGLNAADRLAVGAPIMPPDLSKCGPADLPAGAKPTDCCPPENFKNIVDFKLPSPSSPMRVRPAAQLVDDAYIEKYKKAVALMKALPADDP RNFTQQANVHCAYCDGAYDQIGFPDLEIQIHNSWLFFPWHRYYLYFYERILGKLINDPSFAIPYWNWDSPAGMVLPEFYADPKSPLYDHLRDAKHQPPTLVDLDYNLVDPTVSREQQITS NLTIMYRQMVSNAKTSLLFLGSPYRAGDEP | |||
Physicochemical properties | |||
Number of amino acids: | 270 | ||
Molecular weight: | 30,325.083 | ||
Theoretical pI: | 5.317 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45840 46090 | ||
Instability index: | 46.560 | ||
aromaticity | 0.115 | ||
GRAVY | -0.331 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.259 | ||
sheet | 0.256 |