Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650331.1 | internal | 273 | 2-820(+) |
Amino Acid sequence : | |||
RPENQAQVPLPHNHPTETLKSHHVPLSPNLTTCHRSLSDADRPVYCCPPNPEADEPVIDFQFPDLSTTPVRIRRPAHKLDQAYMSKYNKALTIMKSLPSTDPRSFMRQANIHCIYCTGAY NQKHSNSLLKIHRSRMFFPFHRMMIYFHERILGSLMGDDTFALPFWNWDNPEGMFIPDMYLNGSFIDTQRDRIHLPPQVADIDFDYFERGLGREEQIERNIAFMYHQMISGAKKTELFMG CPYRSGEDGFCDGPGTIELAPHNALHTWVGNSD | |||
Physicochemical properties | |||
Number of amino acids: | 273 | ||
Molecular weight: | 13,837.916 | ||
Theoretical pI: | 9.798 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
Instability index: | 60.965 | ||
aromaticity | 0.110 | ||
GRAVY | -0.146 | ||
Secondary Structure Fraction | |||
Helix | 0.373 | ||
turn | 0.271 | ||
sheet | 0.178 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650331.1 | 5prime_partial | 118 | 820-464(-) |
Amino Acid sequence : | |||
IAVPNPSVQSIMWSKLNCPRPITEPIFTGPVRTSHEQLRLFSSRNHLMVHESYVSLYLFFSSQPSFKVIKINISNLWWKMDPISLRVYERPVQIHIRYEHAFRVVPVPERQSEGIVAH* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 13,837.916 | ||
Theoretical pI: | 9.798 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
Instability index: | 60.965 | ||
aromaticity | 0.110 | ||
GRAVY | -0.146 | ||
Secondary Structure Fraction | |||
Helix | 0.373 | ||
turn | 0.271 | ||
sheet | 0.178 |