Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650338.1 | internal | 267 | 2-802(+) |
Amino Acid sequence : | |||
KREEDLLMAGKHFKYVIIGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPESPARLPGFHVCVGSGGERLAPGWYTEKGIELILSTEIVKVDLASKSLVSAAGLTF KYDTLLIATGSTVIRLTDFGVQGADAKNIFYLREIDDADKLIVAINAKKNGKAVIVGGGYIGLELGAVMKLNNFDVTMVYPEPWCMPRLFTSGIAAFYEGYYANKGIKIVKGTVAVGFDS NADGEVRAVKLKDGRVLGADIVVVGVG | |||
Physicochemical properties | |||
Number of amino acids: | 267 | ||
Molecular weight: | 13,120.560 | ||
Theoretical pI: | 6.381 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
Instability index: | 44.643 | ||
aromaticity | 0.113 | ||
GRAVY | -0.116 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.313 | ||
sheet | 0.139 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650338.1 | 3prime_partial | 127 | 381-1(-) |
Amino Acid sequence : | |||
MSKVSYLKVNPAALTRDFEARSTFTISVLRINSMPFSVYHPGASLSPPLPTQTWKPGSLAGDSGKRYALLRAGRSYGATASFEIIASSPGLTPCFANSLAAYPAATPPPMITYLKCFPAI NKSSSLF | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 13,120.560 | ||
Theoretical pI: | 6.381 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
Instability index: | 44.643 | ||
aromaticity | 0.113 | ||
GRAVY | -0.116 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.313 | ||
sheet | 0.139 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650338.1 | 5prime_partial | 115 | 802-455(-) |
Amino Acid sequence : | |||
ANTNNNNISTEDPSILQFHCSHLPICIGIKSNCNCSLDNFDSFVSIVTFIECSYSRSEETRHAPWFRVHHSNVEVVKLHYSAKLETNVSSTNNHSLTILFCINSYYKFISIINFS* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 13,120.560 | ||
Theoretical pI: | 6.381 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
Instability index: | 44.643 | ||
aromaticity | 0.113 | ||
GRAVY | -0.116 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.313 | ||
sheet | 0.139 |