Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650345.1	5prime_partial	189	3-572(+)
Amino Acid sequence :
NCPYTVWAAAVPGGGRRLERGQSWTFNVNPGTKQARVWGRTGCNFDGNGRGRCQTGDCGGVLQCTGYGQPPNTLAEYALNQFNNLDFIDISLVDGFNIPMEFNGCRPIRCTADINGQCPN ELRAPGGCNNPCTVFKTDEYCCNSGSCQPTRWSRFFKERCPDAYSYPKDDPTSTFTCPGGTNYRVIFCP*
Physicochemical properties
Number of amino acids:		189
Molecular weight:		12,726.610
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		39990 40115
Instability index:		58.872
aromaticity		0.083
GRAVY		-0.822
Secondary Structure Fraction
Helix		0.269
turn		0.259
sheet		0.194

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650345.1	5prime_partial	111	572-237(-)
Amino Acid sequence :
SRAKYNPVVGSTGASESASRIILGITVSIWAPFLKEPGPTCWLTAPRIAAILISLEHSARVVTPTRCPKLVRALPVNVSGAPNWSAPIELHWNIEPIDQRDVYEVQVVELV*
Physicochemical properties
Number of amino acids:		111
Molecular weight:		12,726.610
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		39990 40115
Instability index:		58.872
aromaticity		0.083
GRAVY		-0.822
Secondary Structure Fraction
Helix		0.269
turn		0.259
sheet		0.194

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650345.1	5prime_partial	108	2-328(+)
Amino Acid sequence :
QLSLHGMGRGCPGRWPTARARPIMDLQRESRHEAGQSLGPNWVQLRRKWARPMPDRRLRWCPPVHGLWSATKHLSRIRFKPIQQLGLHRHLVGRWVQYSNGVQWVQTN*
Physicochemical properties
Number of amino acids:		108
Molecular weight:		12,726.610
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		39990 40115
Instability index:		58.872
aromaticity		0.083
GRAVY		-0.822
Secondary Structure Fraction
Helix		0.269
turn		0.259
sheet		0.194