Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650356.1	internal	245	3-737(+)
Amino Acid sequence :
RTFEGSRGPPEPMNIKPQIVNALGPIANVSAPLAPNMERSDRNTPPVSISSLAMDSSRVLDIKPRISDDDKVKSWKLPDIVDPSQLRPLRLPDTTAASKVVRLIYTNSGLAVLALASNAV HKLWKWQRSERNPSGKSTASVMPQLWQPANGTLMTNDINESSPAEDSAACIALSKNDSYVMSASGGKVSLFNMMTFKVMTTFMPPPPAATFLAFHPQDNNIVAIGMEDSTIQIYNVRVDE VKIKL
Physicochemical properties
Number of amino acids:		245
Molecular weight:		16,145.329
Theoretical pI:		5.476
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 7240
Instability index:		47.120
aromaticity		0.072
GRAVY		0.444
Secondary Structure Fraction
Helix		0.320
turn		0.281
sheet		0.314

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650356.1	complete	153	514-53(-)
Amino Acid sequence :
MHAAESSAGLLSFMSLVMRVPFAGCHNCGITDAVDFPDGFRSDRCHFQSLCTAFDARANTASPEFVYINRTTLLAAVVSGNLRGLSWDGSTISGNFQLLTLSSSEILGLISNTLLLSIAR LLIETGGVFLSERSMLGARGAETLAIGPSALTI*
Physicochemical properties
Number of amino acids:		153
Molecular weight:		16,145.329
Theoretical pI:		5.476
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 7240
Instability index:		47.120
aromaticity		0.072
GRAVY		0.444
Secondary Structure Fraction
Helix		0.320
turn		0.281
sheet		0.314