Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650382.1 | internal | 271 | 1-813(+) |
Amino Acid sequence : | |||
ATYRFLWLTPISNLSFFTKSNLSTHSHIMSSASKLEPKAAPISSTATFNVPSSDSDEMDRIADETFERYRSSRMQRSGEGVAIVWFRNDLRVMDNEALSRAWMDSKTVLPVYCVDPRHFG TTHYFGFPKTGALRAQFLMQCLADLRKNLIKLGLNLLIQDGKPEDILPLLAKTFGAHAVYAHRETCSEELLVEQRVKKGLQCVAIPPRGPSEKTGQKPTSPKLQLIWGSTLYHIDDLPFT SGNLPDVYTQFRKSIESKCSIRGCFKLPTSL | |||
Physicochemical properties | |||
Number of amino acids: | 271 | ||
Molecular weight: | 30,506.695 | ||
Theoretical pI: | 9.099 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32805 | ||
Instability index: | 41.223 | ||
aromaticity | 0.092 | ||
GRAVY | -0.297 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.244 | ||
sheet | 0.244 |