Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650414.1 | internal | 264 | 2-793(+) |
Amino Acid sequence : | |||
LQHIILSHNNFTGSVPDAIWMIPELVFLDISYNNLTGNLPNLSSNVDFTSAVLNLSNNQFFGGLAFPLGRFRFVDLSNNYFQGQILDRTRRNSSLVWNCLQNVSIQKTLEACRLFYSGRG LEFDNFGVPNTTQPTGSDTTRKSNRNLTYILAGVLGGLGFIVLLVLALVFCLRKCRRNIGEQRGTDTGPVPAGGGNLGLAGGAINFSGLGEAYSYEQILQATGDFNDSNLIKHGHSGDLF QGILGDGVTVVIKRIDVSSKKDSY | |||
Physicochemical properties | |||
Number of amino acids: | 264 | ||
Molecular weight: | 12,713.759 | ||
Theoretical pI: | 9.638 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 75.830 | ||
aromaticity | 0.087 | ||
GRAVY | -0.215 | ||
Secondary Structure Fraction | |||
Helix | 0.261 | ||
turn | 0.357 | ||
sheet | 0.226 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650414.1 | 5prime_partial | 115 | 792-445(-) |
Amino Acid sequence : | |||
YESFLELTSILFITTVTPSPKIPWKRSPEWPCLMRFESLKSPVACSICSYEYASPRPEKLIAPPASPRLPPPAGTGPVSVPLCSPIFLLHFRRQKTSANTKSTMNPRPPSTPASM* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,713.759 | ||
Theoretical pI: | 9.638 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 75.830 | ||
aromaticity | 0.087 | ||
GRAVY | -0.215 | ||
Secondary Structure Fraction | |||
Helix | 0.261 | ||
turn | 0.357 | ||
sheet | 0.226 |