Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650423.1 | internal | 267 | 1-801(+) |
Amino Acid sequence : | |||
RESLRVFSFKFRVRAMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVSADLRSSIWKQMADAGIKYIPSNTFSHYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGNAAVP AMEMTKWFDTNYHFIVPELGPDTKFSYASHKAVNEYNEAKAFGVDTVPVLVGPVSYLLLSKHAKGTDKSFSLLSLLGSILPVYKEVVAELKAAGASWIQFDEPTLVLDLDSEKLKAFTAA YSELESTLSGVNVVIETYFADVPAEAY | |||
Physicochemical properties | |||
Number of amino acids: | 267 | ||
Molecular weight: | 29,638.339 | ||
Theoretical pI: | 5.461 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46870 46870 | ||
Instability index: | 30.798 | ||
aromaticity | 0.127 | ||
GRAVY | -0.083 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.228 | ||
sheet | 0.288 |