Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650428.1 | internal | 237 | 2-712(+) |
Amino Acid sequence : | |||
GMFLNGASDVASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPFGHMVARRVRDSLPLKLSAHWEVNIGSEDGLKSNSSLVGSMNSDEASSLYDEESGASMDVEEKEKLPEIF LTLKESFLKAFKVMDKELRVHPTIDCFCSGTTAVTMVKQGQDLIIGNVGDSRAILGTRDQDDSLIAVQLTVDLKPNLPGEAERIRKCKGRVFALQDEPEVARVWLPNNDSPGLAMAR | |||
Physicochemical properties | |||
Number of amino acids: | 237 | ||
Molecular weight: | 25,911.036 | ||
Theoretical pI: | 5.008 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
Instability index: | 32.245 | ||
aromaticity | 0.063 | ||
GRAVY | -0.290 | ||
Secondary Structure Fraction | |||
Helix | 0.274 | ||
turn | 0.253 | ||
sheet | 0.262 |