Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650431.1 | 3prime_partial | 206 | 96-713(+) |
Amino Acid sequence : | |||
MASNGEGNAEFSFANGPAGTGWNGLAKIQTNRRHNGICHDDSTTPVKAQTIDELHSLQKKKSAPTTPIKDADGTFAIISEEERQKLQLQSISASLASLTRETGPKLVRGDPARKVEAAKV SNVVDYIPAISVSDSSLKSTHVLYNLSPAELYEQAIKYEKGSFITSTGALATLSGAKTGRSPRDKRVVRDEATEDELWWGKGSPNI | |||
Physicochemical properties | |||
Number of amino acids: | 206 | ||
Molecular weight: | 22,167.465 | ||
Theoretical pI: | 7.823 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
Instability index: | 38.811 | ||
aromaticity | 0.053 | ||
GRAVY | -0.565 | ||
Secondary Structure Fraction | |||
Helix | 0.233 | ||
turn | 0.277 | ||
sheet | 0.248 |