Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650433.1 | 3prime_partial | 205 | 75-689(+) |
Amino Acid sequence : | |||
MGNLLCCVQVDQSTVAIKERFGKFNEVLEPGCHCLPWIFGCQLAGHLSLRLQQLDVRCETKTKDNVFVNVVASVQYRALADKASDAFYKLSNTRTQIQAYVFDVIRASVPKLNLDDAFEQ KNEIAKAVEEELEKAMSAYGYEIVQTLIVDIEPDEHVKRAMNEINAAARLRVAANEKAEAEKILQIKRAEGEAESKYLSGLGIAR | |||
Physicochemical properties | |||
Number of amino acids: | 205 | ||
Molecular weight: | 22,923.005 | ||
Theoretical pI: | 5.538 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14815 | ||
Instability index: | 30.764 | ||
aromaticity | 0.068 | ||
GRAVY | -0.191 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.156 | ||
sheet | 0.327 |