Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650443.1 | 3prime_partial | 236 | 45-752(+) |
Amino Acid sequence : | |||
MASLPLLSMVLCFLSLSMKVSYAALPSELYWQSLLPNTPIPKAVQDLLPPAGKINKPASIGVQPTSIPQYARYASEEQLRQKDYSYFFLEKDLHPGTKLNLHFTKTTTETAFLPRKVAES IPFSSTKLPDILNRFSVKPGSREAEVIKQTIEDCESPAIQGEDRYCATSLESMVDYCAAKLGKNAKVVATKVNDDKITPKQQYTIEEGVKEMGGDKSMVCHNQNYAYAVFYCHLTL | |||
Physicochemical properties | |||
Number of amino acids: | 236 | ||
Molecular weight: | 26,326.026 | ||
Theoretical pI: | 7.565 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23755 | ||
Instability index: | 46.990 | ||
aromaticity | 0.089 | ||
GRAVY | -0.267 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.229 | ||
sheet | 0.271 |