Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650463.1 | internal | 257 | 2-772(+) |
Amino Acid sequence : | |||
AAMAKSYPWLEELRLKRMVVTDESLELISRSFKNFKVLVLCSCEGFTTDGLATIAGNCRNLRELDLRECDVDDHRGQWLNCFPETFTSLVSLNLACLDGDLNFSALERLVGRCTNLKTLR LNQAFPLEKLPNLLSRAPQLVDLGTGAFSADVRPELYSKLASAFAGCKGLRSLSGFWEVAPVYLPAMYPVCAGLTSLNLSYAAIQSPDLVKLIGQCPNLKRLWVLDYIEDSGLEAVAASC KDLEELRVFPSEPYDNE | |||
Physicochemical properties | |||
Number of amino acids: | 257 | ||
Molecular weight: | 28,510.532 | ||
Theoretical pI: | 4.976 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 33055 | ||
Instability index: | 49.609 | ||
aromaticity | 0.086 | ||
GRAVY | 0.038 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.230 | ||
sheet | 0.339 |