Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650464.1 | internal | 242 | 2-727(+) |
Amino Acid sequence : | |||
NIEQGKTYKVVVHVRSMDSVNIAVSLAGSNGSKILATSNISGNFLNWSKVEVLLEAKETDHNSRLQLTTTSQGVIWFDQVSAMPLDTYKGHGFRKDLTEMLVSLKPQFIRFPGGCFVEGE WLRNAFRWKETIGPWEERPGHFGDVWMYWTDDGLGYFEFLQLAEDIGALPVWVFNNGISHNDQVSTSFISPFVQEIFDSIEFARGAPDSTWGSVRAAMGHPEPFDLRYVALGNEDCGKKN YL | |||
Physicochemical properties | |||
Number of amino acids: | 242 | ||
Molecular weight: | 27,279.377 | ||
Theoretical pI: | 5.143 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 58440 58565 | ||
Instability index: | 42.718 | ||
aromaticity | 0.128 | ||
GRAVY | -0.253 | ||
Secondary Structure Fraction | |||
Helix | 0.335 | ||
turn | 0.264 | ||
sheet | 0.219 |