Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650470.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
LVPRVRTLVRGIIEEHRAVHGGSGSGDNGYELTDESDFVDVLLSLDGEGKLNEEDMISILWEMIFRGTDTMGILTEWIMAELILNPNIQAKLQNELDSVVANNHDITDAVVTNLPYLQAV VKETLRVHPPGPLLSWARLSTSDVKLGNGMLIPSNTTAMVNMWAITHDPNLWEDPMVFKPERFLESEGGVNVDVRGNDLRLAPFGAGRRVCPGKNLGLVTVTMWVAKLVQHFKWVEDSEM PVDLS | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 12,101.672 | ||
Theoretical pI: | 6.356 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
Instability index: | 48.125 | ||
aromaticity | 0.068 | ||
GRAVY | -0.466 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.204 | ||
sheet | 0.223 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650470.1 | 5prime_partial | 153 | 739-278(-) |
Amino Acid sequence : | |||
SLRSTGISESSTHLKCCTNLATHMVTVTRPRFLPGHTLRPAPNGASLRSLPLTSTLTPPSLSKNLSGLNTIGSSQRLGSCVIAHMFTIAVVLDGMSIPLPSFTSEVESLAHERRGPGGCT LRVSLTTACRYGRLVTTASVMSWLFATTESSSF* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 12,101.672 | ||
Theoretical pI: | 6.356 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
Instability index: | 48.125 | ||
aromaticity | 0.068 | ||
GRAVY | -0.466 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.204 | ||
sheet | 0.223 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650470.1 | 5prime_partial | 103 | 737-426(-) |
Amino Acid sequence : | |||
TQIHWHLRILDPLEMLHQLSHPHGHSDQTQILTGAHPPTRPERCEPEIIASYIHVNPTFTLQEPLGLEHHWIFPEIGVMRDCPHVHHCRSVRWNEHSIAKLYV* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 12,101.672 | ||
Theoretical pI: | 6.356 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
Instability index: | 48.125 | ||
aromaticity | 0.068 | ||
GRAVY | -0.466 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.204 | ||
sheet | 0.223 |