Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650471.1 | internal | 266 | 3-800(+) |
Amino Acid sequence : | |||
LSRIIVTPQESQSHYHFKDNRVLPSHVDAELANSEAWWYKPEYIINELNTNSVITTPSHDEILPINSATTQRPYTLRGYAYSGGGKKVTRVEVTMDGGDTWQVCELDHPEKPNKYGKYWC WCFWSLEVEVLDLLGAKEIAVRAWDQTLNTQPEKLIWNVMGMMNNCWFRVKMNVCKPHKGEIGLVFEHPTLAGNQSGGWMARQKHLETSEAQPTMKKSVSTPFMNTSAKTFSTSEVKKHN TAESCWIIVHGHVYDCTSFLRTIPVV | |||
Physicochemical properties | |||
Number of amino acids: | 266 | ||
Molecular weight: | 30,406.256 | ||
Theoretical pI: | 6.895 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 73910 74285 | ||
Instability index: | 36.873 | ||
aromaticity | 0.102 | ||
GRAVY | -0.457 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.237 | ||
sheet | 0.214 |