Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650475.1 | internal | 290 | 3-872(+) |
Amino Acid sequence : | |||
RSGFCKSNSTFYSKRKTIALPSKASLDITTFISSRAHHGKIAYVDASTGRHLTFPQVWRAVDSLSTSLLDLGIRKGHVVLVLSPNSIFFPVICLSIMSLGAIITTTNPLNTSREIAKQVA DSKHILAFTTQSLLPKLAGTDLPVVLIGESGEHVKHSLKIVSYLEEMINKEPSQSRVKERVDQDDTATLLYSSGTTGASKGVISSHRNLIAMVQTILNRFRLEDGEQTFLCTVPMFHIYG LAAFASGLLASGSTIVVLSRFELDEMLLAIEKYRATYLPLVPPILIALIN | |||
Physicochemical properties | |||
Number of amino acids: | 290 | ||
Molecular weight: | 20,263.950 | ||
Theoretical pI: | 11.945 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 103.297 | ||
aromaticity | 0.071 | ||
GRAVY | -1.146 | ||
Secondary Structure Fraction | |||
Helix | 0.225 | ||
turn | 0.260 | ||
sheet | 0.189 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650475.1 | 5prime_partial | 169 | 2-511(+) |
Amino Acid sequence : | |||
QKRLLQIEFHFLQQEKNNSSAFKSVPRHNDLHLLPSSPWKDRLRRCLHRSPPHLPASMASRRFTLHLSLGPRHSQRSRRSCPISQLHLLPCNLPLHNVSRRHHHHHQSAQYISRNRKASR RFQTYPRFHHSVSAPKTRRHRSPRRPHRRKWRACEALVEDRFLFGGNDK* | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 20,263.950 | ||
Theoretical pI: | 11.945 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 103.297 | ||
aromaticity | 0.071 | ||
GRAVY | -1.146 | ||
Secondary Structure Fraction | |||
Helix | 0.225 | ||
turn | 0.260 | ||
sheet | 0.189 |