Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650483.1 | internal | 285 | 1-855(+) |
Amino Acid sequence : | |||
EMTEVWTSLASLMGVFAFCQSILNTVFPPELRYASSKLFNRIFNWFSSFCYFDITEIDGVNTNELYNAVQLYLSSSASIVGNRLSLTRAINSSAFTFALSNNDCVIDTFNGATARWEHVV TQRQSQNFSWRPVPDEKRGFTLRIRKKDRPLILDSYLDYIMEKATEIRRKNKDRLLYTNSRGGSLDSRGNPWESVPFKHPSTFETLAMDPGKKLEIMDDLRDFADGQSFYQKTGRAWKRG YLLYGPPGTGKSSMIAAMANYLGYDIYDLELTEVSTNSELRKLLM | |||
Physicochemical properties | |||
Number of amino acids: | 285 | ||
Molecular weight: | 11,895.770 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 80.900 | ||
aromaticity | 0.034 | ||
GRAVY | -0.646 | ||
Secondary Structure Fraction | |||
Helix | 0.110 | ||
turn | 0.475 | ||
sheet | 0.161 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650483.1 | complete | 118 | 98-454(+) |
Amino Acid sequence : | |||
MHRASSSTASSTGSPPSATSTSRRSTASTQTNSTTPFSSTSAVPLPSSGTASVSHVPSTLAPSPSPYPTTTASSTPSMAPPPAGNTSSHNANRKTSLGVLFRTRSEVSRFESGRKTGP* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 11,895.770 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 80.900 | ||
aromaticity | 0.034 | ||
GRAVY | -0.646 | ||
Secondary Structure Fraction | |||
Helix | 0.110 | ||
turn | 0.475 | ||
sheet | 0.161 |